![[KO Validated] Histone H1.0 Rabbit pAb (A3298)](/upload/resize_cache/iblock/58b/340_340_140cd750bba9870f18aada2478b24840a/bbp8veznorusotypdwc3anemzfk0n1tk.jpg "[KO Validated] Histone H1.0 Rabbit pAb (A3298)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] Histone H1.0 Rabbit pAb (A3298)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] Histone H1.0 Rabbit pAb Catalog No. A3298 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-independent histone that is a member of the histone H1 family.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human H1F0 (NP_005309.1). Sequence MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSV Gene ID Swiss Prot Synonyms H10; H1.0; H1F0; H1FV Calculated MW 21kDa Observed MW 30kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples 293T Cellular location Chromosome, Nucleus 
Western blot analysis of extracts from normal (control) and Histone H1.0 knockout (KO) 293T cells, using Histone H1.0 antibody (A3298) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
Immunohistochemistry analysis of paraffin-embedded human colon using [KO Validated] Histone H1.0 Rabbit pAb (A3298) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human liver cancer using [KO Validated] Histone H1.0 Rabbit pAb (A3298) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse liver using [KO Validated] Histone H1.0 Rabbit pAb (A3298) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat brain using [KO Validated] Histone H1.0 Rabbit pAb (A3298) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human H1F0 (NP_005309.1). KO Validated Validated Isotype IgG