![[KO Validated] HIF1AN/FIH1 Rabbit mAb (A3701)](/upload/resize_cache/iblock/f54/340_340_140cd750bba9870f18aada2478b24840a/zdphz6ruyyw0rw5wn5tt7q2dfrs6agki.jpg "[KO Validated] HIF1AN/FIH1 Rabbit mAb (A3701)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] HIF1AN/FIH1 Rabbit mAb (A3701)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] HIF1AN/FIH1 Rabbit mAb Catalog No. A3701 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0826 Background
Enables several functions, including 2-oxoglutarate-dependent dioxygenase activity; NF-kappaB binding activity; and transition metal ion binding activity. Involved in several processes, including negative regulation of Notch signaling pathway; negative regulation of transcription from RNA polymerase II promoter in response to hypoxia; and protein hydroxylation. Located in cytosol; nucleoplasm; and perinuclear region of cytoplasm. Colocalizes with nucleus.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HIF1AN/FIH1 (Q9NWT6). Sequence MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKF Gene ID Swiss Prot Synonyms FIH1 Calculated MW 41kDa Observed MW 40kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples U-87MG, 293T Cellular location Cytoplasm, Nucleus, perinuclear region 
Western blot analysis of extracts from wild type (WT) and HIF1AN/FIH1 knockout (KO) 293T cells, using HIF1AN/FIH1 antibody (A3701) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Western blot analysis of extracts of U-87MG cells, using HIF1AN/FIH1 Rabbit mAb (A3701) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HIF1AN/FIH1 (Q9NWT6). KO Validated Validated Isotype IgG