![[KO Validated] GRK2 Rabbit mAb (A4443)](/upload/resize_cache/iblock/c12/340_340_140cd750bba9870f18aada2478b24840a/6xht4z0i3tj4fg1t914hmkv5y141zull.jpg "[KO Validated] GRK2 Rabbit mAb (A4443)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] GRK2 Rabbit mAb (A4443)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] GRK2 Rabbit mAb Catalog No. A4443 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1013 Background
This gene encodes a member of the G protein-coupled receptor kinase family of proteins. The encoded protein phosphorylates the beta-adrenergic receptor as well as a wide range of other substrates including non-GPCR cell surface receptors, and cytoskeletal, mitochondrial, and transcription factor proteins. Data from rodent models supports a role for this gene in embryonic development, heart function and metabolism. Elevated expression of this gene has been observed in human patients with heart failure and Alzheimer's disease.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 590-689 of human GRK2 (P25098). Sequence WRGEGEAPQSLLTMEEIQSVEETQIKERKCLLLKIRGGKQFILQCDSDPELVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLVQRGSANGL Gene ID Swiss Prot Synonyms BARK1; ADRBK1; BETA-ARK1 Calculated MW 80kDa Observed MW 80kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa, Mouse brain, Mouse spleen, Rat brain Cellular location Cell membrane, Cytoplasm 
Western blot analysis of extracts of various cell lines, using GRK2 Rabbit mAb (A4443) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Western blot analysis of extracts from wild type (WT) and GRK2 knockout (KO) HeLa cells, using GRK2 antibody (A4443) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunofluorescence analysis of HeLa cells using GRK2 Rabbit mAb (A4443) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 590-689 of human GRK2 (P25098). KO Validated Validated Isotype IgG