![[KO Validated] Histone H2A.Z Rabbit mAb (A4599)](/upload/resize_cache/iblock/0fa/340_340_140cd750bba9870f18aada2478b24840a/sjla6imk6yp2bywlo1t0rs2vfv2ync1h.jpg "[KO Validated] Histone H2A.Z Rabbit mAb (A4599)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] Histone H2A.Z Rabbit mAb (A4599)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] Histone H2A.Z Rabbit mAb Catalog No. A4599 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1048 Background
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent member of the histone H2A family that is distinct from other members of the family. Studies in mice have shown that this particular histone is required for embryonic development and indicate that lack of functional histone H2A leads to embryonic lethality.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H2A.Z (P0C0S5). Sequence MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSL Gene ID Swiss Prot Synonyms H2AZ; H2A.z; H2A/z; H2AFZ; H2A.Z-1 Calculated MW 13kDa Observed MW 15kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IP ChIP Recommended dilution - WB 1:1000 - 1:5000
- ChIP 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, 293T, U-87MG, Mouse lung, Mouse testis, Mouse brain, Rat lung, Rat testis Cellular location Chromosome, Nucleus 
Western blot analysis of extracts of various cell lines, using Histone H2A.Z Rabbit mAb (A4599) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Western blot analysis of extracts from wild type(WT) and Histone H2A.Z knockout (KO) 293T(KO) cells, using Histone H2A.Z antibody (A4599) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Chromatin immunoprecipitation analysis of extracts of HeLa cells, using Histone H2A.Z Rabbit mAb antibody (A4599) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
-
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H2A.Z (P0C0S5). KO Validated Validated Isotype IgG