[KO Validated] HIF1AN/FIH1 Rabbit pAb (A5466)

быстрая доставка ~4 недели

Размер

100 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	[KO Validated] HIF1AN/FIH1 Rabbit pAb
Catalog No.	A5466
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables several functions, including 2-oxoglutarate-dependent dioxygenase activity; NF-kappaB binding activity; and transition metal ion binding activity. Involved in several processes, including negative regulation of Notch signaling pathway; negative regulation of transcription from RNA polymerase II promoter in response to hypoxia; and protein hydroxylation. Located in cytosol; nucleoplasm; and perinuclear region of cytoplasm. Colocalizes with nucleus.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-349 of human HIF1AN/FIH1 (NP_060372.2).
Sequence	MAATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPRAEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFLYYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLNDTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYDEQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYERFPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAPTPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN
Gene ID
Swiss Prot
Synonyms	FIH1
Calculated MW	41kDa
Observed MW	40kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IF/ICC IP
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200 IP 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	MCF7, K-562, U-937, 293T, Mouse heart, Mouse skeletal muscle
Cellular location	Cytoplasm, Nucleus, perinuclear region
Customer validation	WB(Homo sapiens, fenugreek, Mus musculus)

Western blot analysis of extracts of various cell lines, using HIF1AN/FIH1 antibody (A5466) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Western blot analysis of extracts from normal (control) and HIF1AN/FIH1 Rabbit pAb knockout (KO) 293T cells, using HIF1AN/FIH1 Rabbit pAb antibody (A5466) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Immunofluorescence analysis of L929 cells using HIF1AN/FIH1 antibody (A5466) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunoprecipitation analysis of 200 μg extracts of 293T cells using 1 μg HIF1AN/FIH1 antibody (A5466). Western blot was performed from the immunoprecipitate using HIF1AN/FIH1 antibody (A5466) at a dilution of 1:1000.

Key applications	Western blotting, Immunofluorescence, Immunoprecipitation
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек, Мышь, Крыса
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-349 of human HIF1AN/FIH1 (NP_060372.2).
KO Validated	Validated
Isotype	IgG