![[KO Validated] CDK8 Rabbit pAb (A5548)](/upload/resize_cache/iblock/d42/340_340_140cd750bba9870f18aada2478b24840a/t8gsqgwoq1h0a6ute2vcs04dffpre7vz.jpg "[KO Validated] CDK8 Rabbit pAb (A5548)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] CDK8 Rabbit pAb (A5548)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] CDK8 Rabbit pAb Catalog No. A5548 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are known to be important regulators of cell cycle progression. This kinase and its regulatory subunit, cyclin C, are components of the Mediator transcriptional regulatory complex, involved in both transcriptional activation and repression by phosphorylation of the carboxy-terminal domain of the largest subunit of RNA polymerase II. This kinase regulates transcription by targeting the cyclin-dependent kinase 7 subunits of the general transcription initiation factor IIH, thus providing a link between the Mediator complex and the basal transcription machinery. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 365-464 of human CDK8 (NP_001251.1). Sequence DDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY Gene ID Swiss Prot Synonyms K35; IDDHBA Calculated MW 53kDa Observed MW 56kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IP Recommended dilution - WB 1:500 - 1:2000
- IP 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Immunoprecipitation Positive samples Jurkat Cellular location Nucleus Customer validation WB(Homo sapiens)
Western blot analysis of extracts of Jurkat cells, using CDK8 antibody (A5548) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Western blot analysis of extracts from normal (control) and CDK8 knockout (KO) HeLa cells, using CDK8 antibody (A5548) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunoprecipitation analysis of 200 μg extracts of Jurkat cells, using 3 μg CDK8 antibody (A5548). Western blot was performed from the immunoprecipitate using CDK8 antibody (A5548) at a dilution of 1:1000.
-
Key applications Western blotting, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 365-464 of human CDK8 (NP_001251.1). KO Validated Validated Isotype IgG