![[KO Validated] PD-1/CD279 Rabbit pAb (A5584)](/upload/resize_cache/iblock/00f/340_340_140cd750bba9870f18aada2478b24840a/anv6h0c2egulbqvz5mzje3ncez3kxhjb.jpg "[KO Validated] PD-1/CD279 Rabbit pAb (A5584)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] PD-1/CD279 Rabbit pAb (A5584)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] PD-1/CD279 Rabbit pAb Catalog No. A5584 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Programmed cell death protein 1 (PDCD1) is an immune-inhibitory receptor expressed in activated T cells; it is involved in the regulation of T-cell functions, including those of effector CD8+ T cells. In addition, this protein can also promote the differentiation of CD4+ T cells into T regulatory cells. PDCD1 is expressed in many types of tumors including melanomas, and has demonstrated to play a role in anti-tumor immunity. Moreover, this protein has been shown to be involved in safeguarding against autoimmunity, however, it can also contribute to the inhibition of effective anti-tumor and anti-microbial immunity.Immunogen information
Immunogen Recombinant fusion protein containing a sequence within amino acids 1-80 of human PD-1/CD279 (NP_005009.2). Sequence MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLA Gene ID Swiss Prot Synonyms PD1; PD-1; CD279; SLEB2; hPD-1; hPD-l; hSLE1 Calculated MW 32kDa Observed MW 35kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Positive samples 293T, RAW264.7, Mouse spleen, Mouse thymus, Rat spleen, Rat thymus Cellular location Membrane, Single-pass type I membrane protein Customer validation WB(Homo sapiens)
Western blot analysis of extracts of various cell lines, using PD-1/CD279 antibody (A5584) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Western blot analysis of extracts from normal (control) and PD-1/CD279 knockout (KO) 293T cells, using PD-1/CD279 antibody (A5584) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence within amino acids 1-80 of human PD-1/CD279 (NP_005009.2). KO Validated Validated Isotype IgG