![[KO Validated] ECE1 Rabbit pAb (A5638)](/upload/resize_cache/iblock/27a/340_340_140cd750bba9870f18aada2478b24840a/dbdehnv4c54vg511a3yimzbw6bwfyx6p.jpg "[KO Validated] ECE1 Rabbit pAb (A5638)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] ECE1 Rabbit pAb (A5638)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] ECE1 Rabbit pAb Catalog No. A5638 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene is involved in proteolytic processing of endothelin precursors to biologically active peptides. Mutations in this gene are associated with Hirschsprung disease, cardiac defects and autonomic dysfunction. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 670-770 of human ECE1 (NP_001388.1). Sequence ADNGGLKAAYRAYQNWVKKNGAEHSLPTLGLTNNQLFFLGFAQVWCSVRTPESSHEGLITDPHSPSRFRVIGSLSNSKEFSEHFRCPPGSPMNPPHKCEVW Gene ID Swiss Prot Synonyms ECE Calculated MW 87kDa Observed MW 130kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:100
- IF/ICC 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples Mouse liver, HeLa Cellular location Cell membrane, Single-pass type II membrane protein 
Western blot analysis of extracts from normal (control) and ECE1 knockout (KO) HeLa cells, using ECE1 antibody (A5638) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s. -
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 670-770 of human ECE1 (NP_001388.1). KO Validated Validated Isotype IgG