быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] Histone H2A.Z Rabbit pAb (A6614)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] Histone H2A.Z Rabbit pAb Catalog No. A6614 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent member of the histone H2A family that is distinct from other members of the family. Studies in mice have shown that this particular histone is required for embryonic development and indicate that lack of functional histone H2A leads to embryonic lethality.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human H2AFZ (NP_002097.1). Sequence MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTV Gene ID Swiss Prot Synonyms H2AZ; H2A.z; H2A/z; H2AFZ; H2A.Z-1 Calculated MW 13kDa Observed MW 15kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Positive samples HL-60, MCF7, 22Rv1, PC-12, HepG2, Mouse testis, Mouse thymus, 293T Cellular location Chromosome, Nucleus Customer validation IHC(Homo sapiens)

Western blot analysis of extracts of various cell lines, using H2AFZ antibody (A6614) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Western blot analysis of extracts from normal (control) and Histone H2A.Z Rabbit pAb knockout (KO) 293T cells, using Histone H2A.Z Rabbit pAb antibody (A6614) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human H2AFZ (NP_002097.1). KO Validated Validated Isotype IgG







