[KO Validated] GPR68 Rabbit pAb (A7348)

быстрая доставка ~4 недели

Размер

100 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	[KO Validated] GPR68 Rabbit pAb
Catalog No.	A7348
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is a G protein-coupled receptor for sphingosylphosphorylcholine. The encoded protein is a proton-sensing receptor, inactive at pH 7.8 but active at pH 6.8. Mutations in this gene are a cause of amelogenesis imperfecta.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 276-365 of human GPR68 (NP_003476.3).
Sequence	SFNCVADPVLYCFVSETTHRDLARLRGACLAFLTCSRTGRAREAYPLGAPEASGKSGAQGEEPELLTKLHPAFQTPNSPGSGGFPTGRLA
Gene ID
Swiss Prot
Synonyms	OGR1; AI2A6; GPR12A
Calculated MW	41kDa
Observed MW	46kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	293T, HL-60, U-87MG, NIH/3T3, Jurkat, Mouse brain, Mouse spleen, Mouse lung, Rat brain
Cellular location	Cell membrane, Multi-pass membrane protein

Western blot analysis of extracts from normal (control) and GPR68 knockout (KO) 293T cells, using GPR68 antibody (A7348) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Key applications	Western blotting
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек, Мышь, Крыса
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 276-365 of human GPR68 (NP_003476.3).
KO Validated	Validated
Isotype	IgG