![[KO Validated] HK1 Rabbit mAb (A0533)](/upload/resize_cache/iblock/331/340_340_140cd750bba9870f18aada2478b24840a/ltitrh9j9mhaer2c1z2rmza5nftk6gz1.jpg "[KO Validated] HK1 Rabbit mAb (A0533)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] HK1 Rabbit mAb (A0533)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] HK1 Rabbit mAb Catalog No. A0533 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0256 Background
Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes a ubiquitous form of hexokinase which localizes to the outer membrane of mitochondria. Mutations in this gene have been associated with hemolytic anemia due to hexokinase deficiency. Alternative splicing of this gene results in several transcript variants which encode different isoforms, some of which are tissue-specific.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Hexokinase 1 (P19367). Sequence GLSRDFNPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPV Gene ID Swiss Prot Synonyms HK; HKD; HKI; HXK1; NMSR; RP79; HMSNR; HK1-ta; HK1-tb; HK1-tc; NEDVIBA; hexokinase Calculated MW 102kDa Observed MW 120kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC IP Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation Positive samples 293T, MCF7, Mouse testis, Mouse brain, Rat testis, Rat brain Cellular location Mitochondrion outer membrane Customer validation (293T、 HeLa 、MCF-7、MLOT-4 、 T-47D)
Western blot analysis of extracts from wild type (WT) and HK1 knockout (KO) 293T cells, using HK1 Rabbit mAb (A0533) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Western blot analysis of extracts of various cell lines, using HK1 Rabbit mAb (A0533) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunohistochemistry of paraffin-embedded mouse kidney using [KO Validated] HK1 Rabbit mAb (A0533) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded rat kidney using [KO Validated] HK1 Rabbit mAb (A0533) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of U2OS using [KO Validated] HK1 Rabbit mAb (A0533) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 600 μg extracts of Mouse brain cells using 3 μg HK1 antibody (A0533). Western blot was performed from the immunoprecipitate using HK1 (A0533) at a dilution of 1:1000.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Hexokinase 1 (P19367). KO Validated Validated Isotype IgG