![[KO Validated] NF2 Rabbit pAb (A0739)](/upload/resize_cache/iblock/135/340_340_140cd750bba9870f18aada2478b24840a/e2rxmflz4cv2oabv6olvjh9aloia8eqm.jpg "[KO Validated] NF2 Rabbit pAb (A0739)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] NF2 Rabbit pAb (A0739)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] NF2 Rabbit pAb Catalog No. A0739 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a protein that is similar to some members of the ERM (ezrin, radixin, moesin) family of proteins that link cytoskeletal components with proteins in the cell membrane. The encoded protein is involved in regulation of contact-dependent inhibition of cell proliferation and functions in cell-cell adhesion and transmembrane signaling. The encoded protein has been shown to interact with cell-surface proteins, proteins involved in cytoskeletal dynamics, and proteins involved in regulating ion transport. Disruption of this protein's function has been implicated in tumorigenesis and metastasis. Mutations in this gene are associated with neurofibromatosis type II which is characterized by nervous system and skin tumors and ocular abnormalities.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 477-576 of human NF2 (NP_000259.1). Sequence TKPTYPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNENSDRGGSSKHNT Gene ID Swiss Prot Synonyms ACN; SCH; BANF; merlin-1 Calculated MW 70kDa Observed MW 73kDaa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC IP Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Immunoprecipitation Positive samples PC-3, Mouse brain, Mouse testis, PC-12, C6 Cellular location Cell projection, Cytoplasm, Cytoplasmic granule, Cytoplasmic side, Nucleus, Nucleus, Peripheral membrane protein, cytoskeleton, filopodium membrane, perinuclear region, ruffle membrane 
Western blot analysis of extracts from normal (control) and NF2 knockout (KO) HeLa cells, using NF2 antibody (A0739) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 6s.
Western blot analysis of various lysates, using NF2 Rabbit pAb (A0739) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Immunofluorescence analysis of C6 cells using NF2 antibody (A0739) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of L929 cells using NF2 antibody (A0739) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U2OS cells using NF2 antibody (A0739) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 200 μg extracts of SKOV3 cells using 3 μg NF2 antibody (A0739). Western blot was performed from the immunoprecipitate using NF2 antibody (A0739) at a dilution of 1:1000.
-
Key applications Western blotting, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 477-576 of human NF2 (NP_000259.1). KO Validated Validated Isotype IgG