[KO Validated] NBS1/NBN Rabbit pAb (A0783)

быстрая доставка ~4 недели

Размер

100 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	[KO Validated] NBS1/NBN Rabbit pAb
Catalog No.	A0783
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Mutations in this gene are associated with Nijmegen breakage syndrome, an autosomal recessive chromosomal instability syndrome characterized by microcephaly, growth retardation, immunodeficiency, and cancer predisposition. The encoded protein is a member of the MRE11/RAD50 double-strand break repair complex which consists of 5 proteins. This gene product is thought to be involved in DNA double-strand break repair and DNA damage-induced checkpoint activation.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 520-754 of human NBS1/NBN (NP_002476.2).
Sequence	NNLFTDTDLKSIVKNSASKSHAAEKLRSNKKREMDDVAIEDEVLEQLFKDTKPELEIDVKVQKQEEDVNVRKRPRMDIETNDTFSDEAVPESSKISQENEIGKKRELKEDSLWSAKEISNNDKLQDDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDLFRYNPYLKRRR
Gene ID
Swiss Prot
Synonyms	ATV; NBS; P95; NBS1; AT-V1; AT-V2
Calculated MW	85kDa
Observed MW	95kDa/70kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	293T, Mouse testis, Rat testis
Cellular location	Chromosome, Nucleus, PML body, telomere
Customer validation	WB(Mouse adipose-derived stem cells, Homo sapiens) IF(Mus musculus) WB(Mus musculus)

Western blot analysis of extracts from normal (control) and NBS1/NBS1/NBN knockout (KO) 293T cells, using NBS1/NBS1/NBN antibody (A0783) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Immunohistochemistry analysis of paraffin-embedded human lung cancer using [KO Validated] NBS1/NBS1/NBN Rabbit pAb (A0783) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Key applications	Western blotting, Immunohistochemistry
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек, Мышь, Крыса
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 520-754 of human NBS1/NBN (NP_002476.2).
KO Validated	Validated
Isotype	IgG