+7-495-308-45-67 Заказать звонок

[KO Validated] HK1 Rabbit pAb (A1054)

быстрая доставка ~4 недели

Размер

100 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	[KO Validated] HK1 Rabbit pAb
Catalog No.	A1054
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes a ubiquitous form of hexokinase which localizes to the outer membrane of mitochondria. Mutations in this gene have been associated with hemolytic anemia due to hexokinase deficiency. Alternative splicing of this gene results in several transcript variants which encode different isoforms, some of which are tissue-specific.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 21-219 of human HK1 (NP_000179.2).
Sequence	KIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGY
Gene ID
Swiss Prot
Synonyms	HK; HKD; HKI; HXK1; NMSR; RP79; HMSNR; HK1-ta; HK1-tb; HK1-tc; NEDVIBA; hexokinase
Calculated MW	102kDa
Observed MW	102kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 IP 1:100 - 1:500
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	293T, MCF7, U-87MG, Mouse testis, Mouse brain, Mouse heart, Rat testis, Rat brain
Cellular location	Mitochondrion outer membrane
Customer validation	WB(Human chronic myeloid leukemia cells, SK-N-SH, U251,U87MG, Homo sapiens, Mus musculus, Gallus gallus) IHC(HeLa cells)

Western blot analysis of extracts of various cell lines, using HK1 antibody (A1054) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Western blot analysis of extracts from normal (control) and HK1 knockout (KO) 293T cells, using HK1 antibody (A1054) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Immunohistochemistry analysis of paraffin-embedded rat kidney using HK1 Rabbit pAb (A1054) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse kidney using HK1 Rabbit pAb (A1054) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunofluorescence analysis of A-549 cells using [KO Validated] HK1 Rabbit pAb (A1054) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] HK1 Rabbit pAb (A1054) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunoprecipitation analysis of 300 μg extracts of 293T cells using 3 μg HK1 antibody (A1054). Western blot was performed from the immunoprecipitate using HK1 antibody (A1054) at a dilution of 1:500.

Key applications	Western blotting, Immunohistochemistry, Immunofluorescence, Immunoprecipitation
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек, Мышь, Крыса
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 21-219 of human HK1 (NP_000179.2).
KO Validated	Validated
Isotype	IgG