![[KO Validated] NADPH oxidase 4 (NOX4) Rabbit pAb (A11274)](/upload/resize_cache/iblock/9c8/340_340_140cd750bba9870f18aada2478b24840a/xrjsxqfmrdu5cr4md5d3sjydm8sk9y5e.jpg "[KO Validated] NADPH oxidase 4 (NOX4) Rabbit pAb (A11274)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] NADPH oxidase 4 (NOX4) Rabbit pAb (A11274)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] NADPH oxidase 4 (NOX4) Rabbit pAb Catalog No. A11274 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a member of the NOX-family of enzymes that functions as the catalytic subunit the NADPH oxidase complex. The encoded protein is localized to non-phagocytic cells where it acts as an oxygen sensor and catalyzes the reduction of molecular oxygen to various reactive oxygen species (ROS). The ROS generated by this protein have been implicated in numerous biological functions including signal transduction, cell differentiation and tumor cell growth. A pseudogene has been identified on the other arm of chromosome 11. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 479-578 of human NADPH oxidase 4 (NOX4) (NP_058627.2). Sequence LHNKFWQENRPDYVNIQLYLSQTDGIQKIIGEKYHALNSRLFIGRPRWKLLFDEIAKYNRGKTVGVFCCGPNSLSKTLHKLSNQNNSYGTRFEYNKESFS Gene ID Swiss Prot Synonyms KOX; KOX-1; RENOX Calculated MW 67kDa Observed MW 65kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples 293T Cellular location Cell junction, Cell membrane, Endoplasmic reticulum membrane, Multi-pass membrane protein, Nucleus, focal adhesion, nucleolus Customer validation WB(Mus musculus, Homo sapiens, Rattus norvegicus)
IHC(Mus musculus)
IF(Mus musculus)
IF(Rattus norvegicus)
WB(Rattus norvegicus)
IHC(Mus musculus,Rattus norvegicus)
IF(Mus musculus,Rattus norvegicus)
Western blot analysis of extracts of 293T cells, using NADPH oxidase 4 (NOX4) antibody (A11274) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Western blot analysis of extracts from normal (control) and NADPH oxidase 4 (NOX4) Rabbit pAb knockout (KO) HeLa cells, using NADPH oxidase 4 (NOX4) Rabbit pAb antibody (A11274) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunohistochemistry analysis of paraffin-embedded human kidney using [KO Validated] NADPH oxidase 4 (NOX4) Rabbit pAb (A11274) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse colon using [KO Validated] NADPH oxidase 4 (NOX4) Rabbit pAb (A11274) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat colon using [KO Validated] NADPH oxidase 4 (NOX4) Rabbit pAb (A11274) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 479-578 of human NADPH oxidase 4 (NOX4) (NP_058627.2). KO Validated Validated Isotype IgG