![[KO Validated] LC3B Rabbit pAb (A11280)](/upload/resize_cache/iblock/63f/340_340_140cd750bba9870f18aada2478b24840a/mgy45smq02qdkllclccbqk7sxm43ybjz.jpg "[KO Validated] LC3B Rabbit pAb (A11280)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] LC3B Rabbit pAb (A11280)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] LC3B Rabbit pAb Catalog No. A11280 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The product of this gene is a subunit of neuronal microtubule-associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. Studies on the rat homolog implicate a role for this gene in autophagy, a process that involves the bulk degradation of cytoplasmic component.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human LC3B (Q9GZQ8). Sequence MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV Gene ID Swiss Prot Synonyms LC3B; ATG8F; MAP1LC3B-a; MAP1A/1BLC3 Calculated MW 15kDa Observed MW 14kDa/16kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples 293T Cellular location Cytoplasm, Cytoplasmic vesicle, Endomembrane system, Lipid-anchor, autophagosome, autophagosome membrane, cytoskeleton Customer validation WB(Rattus norvegicus, Homo sapiens, acyg)
Western blot analysis of extracts of 293T cells, using LC3B antibody (A11280) at 1:1000 dilution.293T cells were treated by Chloroquine (50 μM) at 37℃ for 20 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% BSA.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Western blot analysis of extracts from normal (control) and LC3B knockout (KO) 293T cells, using LC3B antibody (A11280) at 1:1000 dilution.293T cells were treated by Chloroquine (50 μM) at 37℃ for 20 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
Western blot analysis of extracts from normal (control) and LC3B knockout (KO) 293T cells, using LC3B antibody (A11280) at 1:1000 dilution.293T cells were treated by Chloroquine (50 μM) at 37℃ for 20 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunohistochemistry analysis of paraffin-embedded human breast cancer using [KO Validated] LC3B Rabbit pAb (A11280) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse kidney using [KO Validated] LC3B Rabbit pAb (A11280) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat brain using [KO Validated] LC3B Rabbit pAb (A11280) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human LC3B (Q9GZQ8). KO Validated Validated Isotype IgG