- 100 μL
- 200 μL
- 50 μL
- Описание
- Характеристики
-
Overview
Product name [KO Validated] Bax Rabbit pAb Catalog No. A11550 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. The association and the ratio of BAX to BCL2 also determines survival or death of a cell following an apoptotic stimulus. This protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Bax (NP_620116.1). Sequence MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMF Gene ID Swiss Prot Synonyms BCL2L4 Calculated MW 21kDa Observed MW 23kDa Applications
Reactivity Human Tested applications WB IP Recommended dilution - WB 1:500 - 1:1000
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.Key application Western blotting Immunoprecipitation Positive samples HeLa, MCF-7, HT-1080 Cellular location Cytoplasm, Cytoplasm, Mitochondrion membrane, Single-pass membrane protein Customer validation WB(Homo sapiens, Bos taurus, Mus musculus)

Western blot analysis of extracts of various cell lines, using Bax antibody (A11550) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Western blot analysis of extracts from normal (control) and Bax knockout (KO) 293T cells, using Bax antibody (A11550) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Immunoprecipitation analysis of 200 μg extracts of HeLa cells using 3 μg Bax antibody (A11550). Western blot was performed from the immunoprecipitate using Bax antibody (A11550) at a dilution of 1:1000.
-
Key applications Western blotting, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Bax (NP_620116.1). KO Validated Validated Isotype IgG







