![[KO Validated] CD44 Rabbit pAb (A12410)](/upload/resize_cache/iblock/49c/340_340_140cd750bba9870f18aada2478b24840a/uky33iats464reyws1n09sm4zvh6dc2a.jpg "[KO Validated] CD44 Rabbit pAb (A12410)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] CD44 Rabbit pAb (A12410)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] CD44 Rabbit pAb Catalog No. A12410 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene is a cell-surface glycoprotein involved in cell-cell interactions, cell adhesion and migration. It is a receptor for hyaluronic acid (HA) and can also interact with other ligands, such as osteopontin, collagens, and matrix metalloproteinases (MMPs). This protein participates in a wide variety of cellular functions including lymphocyte activation, recirculation and homing, hematopoiesis, and tumor metastasis. Transcripts for this gene undergo complex alternative splicing that results in many functionally distinct isoforms, however, the full length nature of some of these variants has not been determined. Alternative splicing is the basis for the structural and functional diversity of this protein, and may be related to tumor metastasis.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-178 of human CD44 (NP_000601.3). Sequence AQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDV Gene ID Swiss Prot Synonyms IN; LHR; MC56; MDU2; MDU3; MIC4; Pgp1; CDW44; CSPG8; H-CAM; HCELL; ECM-III; HUTCH-1; HUTCH-I; ECMR-III; Hermes-1 Calculated MW 82kDa Observed MW 80kDa Applications
Reactivity Human, Mouse Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HeLa, HUVEC, Mouse spleen Cellular location Cell membrane, Single-pass type I membrane protein Customer validation FC(Homo sapiens)
IF(Mus musculus, Homo sapiens)
WB(Homo sapiens, Bovine)
IHC(Homo sapiens)
Western blot analysis of extracts of various cell lines, using CD44 antibody (A12410) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts from normal (control) and CD44 knockout (KO) HeLa cells, using CD44 antibody (A12410) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded human esophageal cancer using [KO Validated] CD44 Rabbit pAb (A12410) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human lung cancer using [KO Validated] CD44 Rabbit pAb (A12410) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of HeLa cells using CD44 antibody (A12410) at dilution of 1:100. Blue: DAPI for nuclear staining.
Confocal immunofluorescence analysis of A431 cells using CD44 antibody (A12410) at dilution of 1:200. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of RAW264.7 cells using CD44 antibody (A12410) at dilution of 1:100. Blue: DAPI for nuclear staining.
Confocal immunofluorescence analysis of HeLa cells using [KO Validated] CD44 Polyclonal Antibody (A12410) at dilution of 1:100. Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-178 of human CD44 (NP_000601.3). KO Validated Validated Isotype IgG