![[KO Validated] MEK1 Rabbit pAb (A12687)](/upload/resize_cache/iblock/2cf/340_340_140cd750bba9870f18aada2478b24840a/lwi5v66y70wfko7fkod8zmib5dk53d0k.jpg "[KO Validated] MEK1 Rabbit pAb (A12687)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] MEK1 Rabbit pAb (A12687)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] MEK1 Rabbit pAb Catalog No. A12687 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene is a member of the dual specificity protein kinase family, which acts as a mitogen-activated protein (MAP) kinase kinase. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This protein kinase lies upstream of MAP kinases and stimulates the enzymatic activity of MAP kinases upon wide variety of extra- and intracellular signals. As an essential component of MAP kinase signal transduction pathway, this kinase is involved in many cellular processes such as proliferation, differentiation, transcription regulation and development.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MEK1 (NP_002746.1). Sequence MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIH Gene ID Swiss Prot Synonyms MEL; CFC3; MEK1; MKK1; MAPKK1; PRKMK1 Calculated MW 43kDa Observed MW 45kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P Recommended dilution - WB 1:1000 - 1:3000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples Jurkat, HeLa, A-431, MCF-7, Mouse Liver, Mouse Kidney, Rat Thymus Cellular location Cytoplasm, Membrane, Nucleus, Peripheral membrane protein, centrosome, cytoskeleton, microtubule organizing center, spindle pole body Customer validation WB(Rattus norvegicus)
Western blot analysis of extracts of various cell lines, using MEK1 antibody (A12687) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.
Western blot analysis of extracts from normal (control) and MEK1 knockout (KO) HeLa cells, using MEK1 antibody (A12687) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Immunohistochemistry analysis of paraffin-embedded Rat brain using MEK1 antibody (A12687) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded mouse kidney using MEK1 antibody (A12687) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MEK1 (NP_002746.1). KO Validated Validated Isotype IgG