![[KO Validated] KRAS Rabbit pAb (A12704)](/upload/resize_cache/iblock/b7c/340_340_140cd750bba9870f18aada2478b24840a/5caqtlw3yaelf4q83t2kx4yij90yapnt.jpg "[KO Validated] KRAS Rabbit pAb (A12704)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] KRAS Rabbit pAb (A12704)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] KRAS Rabbit pAb Catalog No. A12704 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene, a Kirsten ras oncogene homolog from the mammalian ras gene family, encodes a protein that is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma. Alternative splicing leads to variants encoding two isoforms that differ in the C-terminal region.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-188 of human KRAS (NP_004976.2). Sequence DEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKCVIM Gene ID Swiss Prot Synonyms NS; NS3; OES; CFC2; RALD; K-Ras; KRAS1; KRAS2; RASK2; KI-RAS; C-K-RAS; K-RAS2A; K-RAS2B; K-RAS4A; K-RAS4B; K-Ras 2; 'C-K-RAS; c-Ki-ras; c-Ki-ras2 Calculated MW 22kDa Observed MW 21kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:1000 - 1:5000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples Mouse brain, Rat brain Cellular location Cell membrane, Cytoplasm, Cytoplasmic side, Lipid-anchor, cytosol Customer validation WB(Homo sapiens, Mus musculus)
Western blot analysis of extracts from normal (control) and KRAS knockout (KO) 293T cells, using KRAS antibody (A12704) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Western blot analysis of various lysates, using KRAS antibody (A12704) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunofluorescence analysis of L929 cells using [KO Validated] KRAS Rabbit pAb (A12704) at dilution of 100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-188 of human KRAS (NP_004976.2). KO Validated Validated Isotype IgG