![[KO Validated] CDK7 Rabbit pAb (A12942)](/upload/resize_cache/iblock/aae/340_340_140cd750bba9870f18aada2478b24840a/620cifw2xm5ruh5zeqr5d6qbhakpxo2k.jpg "[KO Validated] CDK7 Rabbit pAb (A12942)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] CDK7 Rabbit pAb (A12942)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] CDK7 Rabbit pAb Catalog No. A12942 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28, and Schizosaccharomyces pombe cdc2, and are known to be important regulators of cell cycle progression. This protein forms a trimeric complex with cyclin H and MAT1, which functions as a Cdk-activating kinase (CAK). It is an essential component of the transcription factor TFIIH, that is involved in transcription initiation and DNA repair. This protein is thought to serve as a direct link between the regulation of transcription and the cell cycle.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 211-346 of human CDK7 (NP_001790.1). Sequence PFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF Gene ID Swiss Prot Synonyms CAK; CAK1; HCAK; MO15; STK1; CDKN7; p39MO15 Calculated MW 39kDa Observed MW 40kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples 293T Cellular location Cytoplasm, Nucleus, perinuclear region Customer validation WB(Human colon cancer cell, Homo sapiens)
IHC(Human colon cancer cell)
Western blot analysis of extracts of various cell lines, using CDK7 antibody (A12942) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.
Western blot analysis of extracts from normal (control) and CDK7 knockout (KO) 293T cells, using CDK7 antibody (A12942) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 211-346 of human CDK7 (NP_001790.1). KO Validated Validated Isotype IgG