![[KO Validated] IFITM3 Rabbit pAb (A13070)](/upload/resize_cache/iblock/e79/340_340_140cd750bba9870f18aada2478b24840a/zxjkt1jubv8pyco6wmka3my6xpw62y08.jpg "[KO Validated] IFITM3 Rabbit pAb (A13070)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KO Validated] IFITM3 Rabbit pAb (A13070)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] IFITM3 Rabbit pAb Catalog No. A13070 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Interferon-induced transmembrane (IFITM) proteins are a family of interferon induced antiviral proteins. The family contains five members, including IFITM1, IFITM2 and IFITM3 and belong to the CD225 superfamily. The protein encoded by this gene restricts cellular entry by diverse viral pathogens, such as influenza A virus, Ebola virus and Sars-CoV-2.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-133 of human IFITM3 (NP_066362.2). Sequence MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG Gene ID Swiss Prot Synonyms 1-8U; IP15; DSPA2b Calculated MW 15kDa Observed MW 15kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HeLa Cellular location Cell membrane, Late endosome membrane, Lysosome membrane, Single-pass type II membrane protein Customer validation WB(Homo sapiens)
WB IHC(Homo sapiens)
Western blot analysis of extracts of HeLa cells, using IFITM3 antibody (A13070) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Western blot analysis of extracts from normal (control) and IFITM3 knockout (KO) HeLa cells, using IFITM3 antibody (A13070) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma using [KO Validated] IFITM3 Rabbit pAb (A13070) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunofluorescence analysis of C6 cells using [KO] IFITM3 antibody (A13070) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of L929 cells using [KO] IFITM3 antibody (A13070) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using [KO] IFITM3 antibody (A13070) at dilution of 1:100. Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-133 of human IFITM3 (NP_066362.2). KO Validated Validated Isotype IgG