+7-495-308-45-67 Заказать звонок

[KO Validated] HADHA Rabbit pAb (A13310)

быстрая доставка ~4 недели

Размер

100 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	[KO Validated] HADHA Rabbit pAb
Catalog No.	A13310
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes the alpha subunit of the mitochondrial trifunctional protein, which catalyzes the last three steps of mitochondrial beta-oxidation of long chain fatty acids. The mitochondrial membrane-bound heterocomplex is composed of four alpha and four beta subunits, with the alpha subunit catalyzing the 3-hydroxyacyl-CoA dehydrogenase and enoyl-CoA hydratase activities. Mutations in this gene result in trifunctional protein deficiency or LCHAD deficiency. The genes of the alpha and beta subunits of the mitochondrial trifunctional protein are located adjacent to each other in the human genome in a head-to-head orientation.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 484-763 of human HADHA (NP_000173.2).
Sequence	IAAVSKRPEKVIGMHYFSPVDKMQLLEIITTEKTSKDTSASAVAVGLKQGKVIIVVKDGPGFYTTRCLAPMMSEVIRILQEGVDPKKLDSLTTSFGFPVGAATLVDEVGVDVAKHVAEDLGKVFGERFGGGNPELLTQMVSKGFLGRKSGKGFYIYQEGVKRKDLNSDMDSILASLKLPPKSEVSSDEDIQFRLVTRFVNEAVMCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRFVDLYGAQKIVDRLKKYEAAYGKQFTPCQLLADHANSPNKKFYQ
Gene ID
Swiss Prot
Synonyms	GBP; ECHA; HADH; LCEH; MTPA; LCHAD; TP-ALPHA
Calculated MW	83kDa
Observed MW	78kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP
Recommended dilution	WB 1:2000 - 1:6000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 IP 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	293T, K-562
Cellular location	Mitochondrion
Customer validation	WB(Homo sapiens)

Western blot analysis of extracts of K-562 cells, using HADHA antibody (A13310) at 1:5000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Western blot analysis of extracts from normal (control) and HADHA knockout (KO) 293T cells, using HADHA antibody (A13310) at 1:5000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Immunohistochemistry analysis of paraffin-embedded human liver cancer using HADHA antibody (A13310) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human esophageal cancer using HADHA antibody (A13310) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunofluorescence analysis of A-549 cells using HADHA antibody (A13310). Blue: DAPI for nuclear staining.

Confocal immunofluorescence analysis of U2OS cells using HADHA Polyclonal Antibody (A13310) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunoprecipitation analysis of 200 μg extracts of HeLa cells using 3 μg HADHA antibody (A13310). Western blot was performed from the immunoprecipitate using HADHA antibody (A13310) at a dilution of 1:1000.

Key applications	Western blotting, Immunohistochemistry, Immunofluorescence, Immunoprecipitation
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек, Мышь
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 484-763 of human HADHA (NP_000173.2).
KO Validated	Validated
Isotype	IgG