[KO Validated] CHRAC1 Rabbit pAb (A14896)

быстрая доставка ~4 недели

Размер

100 μL
200 μL
50 μL

Описание
Характеристики

Overview

Product name	[KO Validated] CHRAC1 Rabbit pAb
Catalog No.	A14896
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

CHRAC1 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-131 of human CHRAC1 (NP_059140.1).
Sequence	MADVVVGKDKGGEQRLISLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQCLATYSYRHGSGKEKKVLTYSDLANTAQQSETFQFLADILPKKILASKYLKMLKEEKREEDEENDNDNESDHDEADS
Gene ID
Swiss Prot
Synonyms	YCL1; CHARC1; CHARC15; CHRAC-1; CHRAC15; CHRAC-15
Calculated MW	15kDa
Observed MW	14kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa
Cellular location	Nucleus
Customer validation	WB(Homo sapiens) IHC(Homo sapiens) IF(Homo sapiens)

Western blot analysis of extracts from normal (control) and CHRAC1 knockout (KO) HeLa cells, using CHRAC1 antibody (A14896) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.

Key applications	Western blotting
Host species	Кролик
Antibody type	Primary Antibodies
Reactivity	Человек, Мышь, Крыса
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-131 of human CHRAC1 (NP_059140.1).
KO Validated	Validated
Isotype	IgG