![[KO Validated] HDAC8 Rabbit mAb (A8865)](/upload/resize_cache/iblock/18f/340_340_140cd750bba9870f18aada2478b24840a/4p6sotqywsntoy9sfumx6dtsky38l164.jpg "[KO Validated] HDAC8 Rabbit mAb (A8865)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
[KO Validated] HDAC8 Rabbit mAb (A8865)
- Описание
- Характеристики
-
Overview
Product name [KO Validated] HDAC8 Rabbit mAb Catalog No. A8865 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1331 Background
Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to class I of the histone deacetylase family. It catalyzes the deacetylation of lysine residues in the histone N-terminal tails and represses transcription in large multiprotein complexes with transcriptional co-repressors. Multiple transcript variants encoding different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HDAC8 (Q9BY41). Sequence MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGY Gene ID Swiss Prot Synonyms HD8; WTS; RPD3; CDA07; CDLS5; KDAC8; MRXS6; HDACL1 Calculated MW 42kDa Observed MW 42kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IHC-P IF/ICC IP Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
- IP 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation Positive samples 293T, HeLa, Raji, Mouse thymus, Rat brain, Rat thymus Cellular location Cytoplasm, Nucleus Customer validation WB(Homo sapiens, Mus musculus, Rattus norvegicus)
IHC(Homo sapiens,Mus musculus,Rattus norvegicus)
Western blot analysis of extracts from various cell lines, using HDAC8 Rabbit mAb (A8865) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of extracts from various cell lines, using HDAC8 Rabbit mAb (A8865) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
Western blot analysis of extracts from wild type (WT) and HDAC8 knockout (KO) 293T cells, using HDAC8 antibody (A8865) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded rat brain using HDAC8 Rabbit mAb (A8865) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Confocal imaging of HeLa cells using [KO Validated] HDAC8 Rabbit mAb (A8865, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
Immunoprecipitation analysis of 300 μg extracts from HeLa cells using 3 μg HDAC8 antibody (A8865). Western blot was performed from the immunoprecipitate using HDAC8 antibody (A8865) at a dilution of 1:1000.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HDAC8 (Q9BY41). KO Validated Validated Isotype IgG