быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Methyl-HP1 gamma/CBX3-H175 Rabbit pAb (A18812)
- Описание
- Характеристики
-
Overview
Product name Methyl-HP1 gamma/CBX3-H175 Rabbit pAb Catalog No. A18812 Host species Rabbit Purification method Affinity purification Isotype IgG Background
At the nuclear envelope, the nuclear lamina and heterochromatin are adjacent to the inner nuclear membrane. The protein encoded by this gene binds DNA and is a component of heterochromatin. This protein also can bind lamin B receptor, an integral membrane protein found in the inner nuclear membrane. The dual binding functions of the encoded protein may explain the association of heterochromatin with the inner nuclear membrane. This protein binds histone H3 tails methylated at Lys-9 sites. This protein is also recruited to sites of ultraviolet-induced DNA damage and double-strand breaks. Two transcript variants encoding the same protein but differing in the 5' UTR, have been found for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-183 of human HP1 gamma/CBX3 (NP_009207.2). Sequence MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ Gene ID Swiss Prot Synonyms HECH; HP1-GAMMA; HP1Hs-gamma Calculated MW 21kDa Observed MW Refer to figures Applications
Reactivity Human Tested applications DB Recommended dilution - DB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Positive samples Cellular location Nucleus 
Dot-blot analysis of all sorts of peptides using Methyl-HP1 gamma/CBX3-H175 Rabbit pAb (A18812) at 1:1000 dilution.
-
Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-183 of human HP1 gamma/CBX3 (NP_009207.2). Isotype IgG







