быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
Symmetric DiMethyl-Histone H3-R8 Rabbit mAb (A21207)
- Описание
- Характеристики
-
Overview
Product name Symmetric DiMethyl-Histone H3-R8 Rabbit mAb Catalog No. A21207 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC53358 Background
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6p22-p21.3.Immunogen information
Immunogen A synthetic symmetric dimethylated peptide around R8 of human Histone H3 (NP_003520.1). Sequence MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY Gene ID Swiss Prot Synonyms H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A Calculated MW 16kDa Observed MW 17kDa Applications
Reactivity Human, Mouse, Rat, Other (Wide Range) Tested applications WB IHC-P IF/ICC IP ChIP DB Recommended dilution - DB 1:10000 - 1:120000
- WB 1:2000 - 1:10000
- IHC-P 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
- ChIP 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples HeLa, NIH/3T3, C6 Cellular location Chromosome, Nucleus 
Western blot analysis of various lysates, using SymmetricDiMethyl-HistoneH3-R8 antibody (A21207) at 1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Dot-blot analysis of all sorts of peptides using Symmetric DiMethyl-Histone H3-R8 antibody (A21207) at 1:1000 dilution.
Immunohistochemistry analysis of paraffin-embedded Human colon using Symmetric DiMethyl-Histone H3-R8 antibody (A21207) at dilution of 1:1000(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded Rat liver using Symmetric DiMethyl-Histone H3-R8 antibody (A21207) at dilution of 1:1000(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded Mouse kidney using Symmetric DiMethyl-Histone H3-R8 antibody (A21207) at dilution of 1:1000(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Confocal imaging of U-2 0S cells using Symmetric DiMethyl-Histone H3-R8 Rabbit mAb (A21207, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.
Chromatin immunoprecipitation analysis of extracts of HeLa cells, using Symmetric DiMethyl-Histone H3-R8 Rabbit mAb antibody (A21207) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса, Другое (Широкий ассортимент) Immunogen A synthetic symmetric dimethylated peptide around R8 of human Histone H3 (NP_003520.1). Isotype IgG