быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
TriMethyl-Histone H3-K27 Rabbit mAb (A22006)
- Описание
- Характеристики
-
Overview
Product name TriMethyl-Histone H3-K27 Rabbit mAb Catalog No. A22006 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC54169 Background
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is located separately from the other H3 genes that are in the histone gene cluster on chromosome 6p22-p21.3.Immunogen information
Immunogen A synthetic trimethylated peptide around K27 of human Histone H3 (NP_003520.1). Sequence MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY Gene ID Swiss Prot Synonyms H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3 Calculated MW 16kDa Observed MW 17kd Applications
Reactivity Human, Mouse, Rat, Other (Wide Range) Tested applications WB IF/ICC IP ChIP DB Recommended dilution - DB 1:2000 - 1:20000
- WB 1:10000 - 1:30000
- IF/ICC 1:500 - 1:1000
- IP 1:50 - 1:200
- CHIP 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Immunoprecipitation Positive samples Hela, HCT 116, NIH/3T3, C6, 293F Cellular location Chromosome, Nucleus 
Western blot analysis of extracts ofvarious cell lines, using TriMethyl-Histone H3-K27 antibody (A22006) at1:10000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunofluorescence analysis of C6 cells using TriMethyl-Histone H3-K27 Rabbit mAb (A22006) at dilution of 1:600 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HeLa cells using TriMethyl-Histone H3-K27 Rabbit mAb (A22006) at dilution of 1:600 (40x lens). Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 600 μg extracts of 293F cells using 5 μg TriMethyl-Histone H3-K27 Rabbit mAb (A22006). Western blot was performed from the immunoprecipitate using TriMethyl-Histone H3-K27 Rabbit mAb (A22006) at a dilution of 1:200000.
Chromatin immunoprecipitation analysis of extracts of HeLa cells, using TriMethyl-Histone H3-K27 antibody (A22006) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
-
Key applications Western blotting, Immunofluorescence, Immunoprecipitation Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса, Другое (Широкий ассортимент) Immunogen A synthetic trimethylated peptide around K27 of human Histone H3 (NP_003520.1). Isotype IgG