- 100 μL
- 200 μL
- 50 μL
- Описание
- Характеристики
-
Overview
Product name DiMethyl-Histone H3-K79 Rabbit mAb Catalog No. A22142 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC54135 Background
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is located separately from the other H3 genes that are in the histone gene cluster on chromosome 6p22-p21.3.Immunogen information
Immunogen A synthetic dimethylated peptide around K79 of human Histone H3-K79 (NP_003520.1). Sequence MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY Gene ID Swiss Prot Synonyms H3t; H3.4; H3/g; H3FT; H3C16; HIST3H3 Calculated MW 16kDa Observed MW 17kDa Applications
Reactivity Human, Mouse, Rat, Other (Wide Range) Tested applications WB IP ChIP ChIP-seq DB Recommended dilution - DB 1:1000 - 1:5000
- WB 1:1000 - 1:5000
- ChIP 1:50 - 1:200
- ChIP-seq 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples MCF7, NIH/3T3 Cellular location Extracellular exosome, Nucleoplasm, Nucleus 
Chromatin immunoprecipitations were performed with cross-linked chromatin from 293T cells and DiMethyl-Histone H3-K79 Rabbit mAb (A22142). The ChIP sequencing results indicate the enrichment pattern of DiMethyl-Histone H3-K79 in selected genomic region and representative gene loci (RPL30), as shown in figure.

Western blot analysis of MCF7, using DiMethyl-Histone H3-K79 antibody (A22142) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Western blot analysis of NIH/3T3, using DiMethyl-Histone H3-K79 antibody (A22142) at1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Dot-blot analysis of all sorts of peptides using DiMethyl-Histone H3-K79 antibody (A22142) at 1:2000 dilution.

Chromatin immunoprecipitation analysis of extracts of HeLa cells, using DiMethyl-Histone H3-K79 antibody (A22142) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
-
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса, Другое (Широкий ассортимент) Immunogen A synthetic dimethylated peptide around K79 of human Histone H3-K79 (NP_003520.1). Isotype IgG







