быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
DiMethyl-Histone H4-K20 Rabbit mAb (A22268)
- Описание
- Характеристики
-
Overview
Product name DiMethyl-Histone H4-K20 Rabbit mAb Catalog No. A22268 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC55058 Background
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H4 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in a histone cluster on chromosome 1. This gene is one of four histone genes in the cluster that are duplicated; this record represents the centromeric copy.Immunogen information
Immunogen A synthetic dimethylated peptide around K20 of human Histone H4 (NP_003539.1). Sequence MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG Gene ID Swiss Prot Synonyms H4; H4/n; H4C1; H4C2; H4C3; H4C4; H4C5; H4C6; H4C8; H4C9; H4F2; H4FN; FO108; H4-16; H4C11; H4C12; H4C13; H4C15; H4C16; HIST2H4; HIST2H4A Calculated MW 11kDa Observed MW 11kDa Applications
Reactivity Human, Mouse, Rat, Other (Wide Range) Tested applications WB IHC-P IF/ICC DB Recommended dilution - DB 1:500 - 1:1000
- WB 1:500 - 1:1000
- IHC-P 1:500 - 1:1000
- IF/ICC 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Immunofluorescence Positive samples 293F, NIH/3T3, C6 Cellular location Chromosome, Nucleus 
Western blot analysis of various lysates, using DiMethyl-Histone H4-K20 antibody (A22268) at1:120000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Dot-blot analysis of all sorts of peptides using DiMethyl-Histone H4-K20 Rabbit mAb antibody (A22268) at 1:1000 dilution.
Immunohistochemistry analysis of paraffin-embedded human cervix cancer using DiMethyl-Histone H4-K20 Rabbit mAb (A22268) at dilution of 1:1000(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human spleen using DiMethyl-Histone H4-K20 Rabbit mAb (A22268) at dilution of 1:1000(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat lung using DiMethyl-Histone H4-K20 Rabbit mAb (A22268) at dilution of 1:1000(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of HeLa using DiMethyl-Histone H4-K20 Rabbit mAb (A22268) at dilution of 1:600(40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса, Другое (Широкий ассортимент) Immunogen A synthetic dimethylated peptide around K20 of human Histone H4 (NP_003539.1). Isotype IgG