быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
TriMethyl-Histone H3-K9 Rabbit mAb (A22295)
- Описание
- Характеристики
-
Overview
Product name TriMethyl-Histone H3-K9 Rabbit mAb Catalog No. A22295 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC54898 Background
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is located separately from the other H3 genes that are in the histone gene cluster on chromosome 6p22-p21.3.Immunogen information
Immunogen A synthetic trimethylated peptide around K9 of human Histone H3 (NP_003520.1). Sequence MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY Gene ID Swiss Prot Synonyms H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A Calculated MW 15kDa Observed MW 17kDa Applications
Reactivity Human, Mouse, Rat, Other (Wide Range) Tested applications WB IF/ICC IP ChIP ChIP-seq DB CUT&Tag Recommended dilution - WB 1:2000 - 1:20000
- IF/ICC 1:50 - 1:200
- ChIP 1:50 - 1:200
- ChIP-seq 1:20 - 1:100
- DB 1:2000 - 1:20000
- CUT&Tag 10⁵ cells /1 μg
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa, C2C12 , C6 Cellular location Chromosome, Nucleus 
Chromatin immunoprecipitations were performed with cross-linked chromatin from HeLa cells and TriMethyl-Histone H3-K9 mAb (A22295). The ChIP sequencing results indicate the enrichment pattern of TriMethyl-Histone H3-K9 in selected genomic region and representative gene loci (ZNF404, GAPDH), as shown in figure.
CUT&Tag was performed using the CUT&Tag Assay Kit (pAG-Tn5) for Illumina(RK20265) from 10⁵ K562 cells with 1 μg TriMethyl-Histone H3-K9 Rabbit mAb (A22295), along with a Goat Anti-Rabbit IgG(H+L). The CUT&Tag results indicate the enrichment pattern of TriMethyl-Histone H3-K9 in representative gene loci (MYT1), as shown in figure.
Western blot analysis of extracts of various lysates, using TriMethyl-Histone H3-K9 antibody (A22295) at 1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
Dot-blot analysis of all sorts of peptides using TriMethyl-Histone H3-K9 antibody (A22295) at 1:20000 dilution.
Confocal imaging of HeLa cells using TriMethyl-Histone H3-K9 Rabbit mAb (A22295, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
Chromatin immunoprecipitation analysis of extracts of HeLa cells, using TriMethyl-Histone H3-K9 antibody (A22295) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса, Другое (Широкий ассортимент) Immunogen A synthetic trimethylated peptide around K9 of human Histone H3 (NP_003520.1). Isotype IgG