быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
MonoMethyl-Histone H3-K36 Rabbit mAb (A22863)
- Описание
- Характеристики
-
Overview
Product name MonoMethyl-Histone H3-K36 Rabbit mAb Catalog No. A22863 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC54738 Background
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6p22-p21.3.Immunogen information
Immunogen A synthetic monomethylated peptide around K36 of human histone H3(NP_003520.1). Sequence MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAY Gene ID Swiss Prot Synonyms H3/A; H3C2; H3C3; H3C4; H3C6; H3C7; H3C8; H3FA; H3C10; H3C11; H3C12; HIST1H3A Calculated MW 15kDa Observed MW 17kDa Applications
Reactivity Human, Mouse, Rat, Other (Wide Range) Tested applications WB IHC-P DB Recommended dilution - DB 1:500 - 1:1000
- WB 1:500 - 1:1000
- IHC-P 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples Hela, NIH/3T3 Cellular location Chromosome, Nucleus 
Western blot analysis of various lysates, using MonoMethyl-Histone H3-K36 antibody (A22863) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Dot-blot analysis of all sorts of peptides using MonoMethyl-Histone H3-K36 antibody (A22863) at 1:1000 dilution.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using MonoMethyl-Histone H3-K36 Rabbit mAb (A22863) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded rat brain using MonoMethyl-Histone H3-K36 Rabbit mAb (A22863) at dilution of 1:1000 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса, Другое (Широкий ассортимент) Immunogen A synthetic monomethylated peptide around K36 of human histone H3(NP_003520.1). Isotype IgG