быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
β-arrestin1 Rabbit mAb (A10742)
- Описание
- Характеристики
-
Overview
Product name β-arrestin1 Rabbit mAb Catalog No. A10742 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2370 Background
Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. Arrestin beta 1 is a cytosolic protein and acts as a cofactor in the beta-adrenergic receptor kinase (BARK) mediated desensitization of beta-adrenergic receptors. Besides the central nervous system, it is expressed at high levels in peripheral blood leukocytes, and thus the BARK/beta-arrestin system is believed to play a major role in regulating receptor-mediated immune functions. Alternatively spliced transcripts encoding different isoforms of arrestin beta 1 have been described.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human β-arrestin1 (P49407). Sequence MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRL Gene ID Swiss Prot Synonyms ARB1; ARR1 Calculated MW 47kDa Observed MW 51kDa Applications
Reactivity Human, Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples K-562, Mouse lung, Mouse spleen, Mouse kidney Cellular location Cell membrane, Cell projection, Cytoplasm, Cytoplasmic vesicle, Membrane, Nucleus, clathrin-coated pit, pseudopodium 
Western blot analysis of extracts of various cell lines, using β-arrestin1 Rabbit mAb (A10742) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human β-arrestin1 (P49407). Isotype IgG