быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
ABCG1 Rabbit mAb (A17907)
- Описание
- Характеристики
-
Overview
Product name ABCG1 Rabbit mAb Catalog No. A17907 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC0336 Background
The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. It is involved in macrophage cholesterol and phospholipids transport, and may regulate cellular lipid homeostasis in other cell types. Six alternative splice variants have been identified.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human ABCG1 (NP_004906.3). Sequence LLKGISGKFNSGELVAIMGPSGAGKSTLMNILAGYRETGMKGAVLINGLPRDLRCFRKVSCYIMQDDMLLPHLTVQEAMMVSAHLKLQEKDEGRREMVKEI Gene ID Swiss Prot Synonyms ABC8; WHITE1 Calculated MW 76kDa Observed MW 110kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples Hep G2, A-549, HeLa, Mouse liver, Mouse thymus, Rat spleen Cellular location Endoplasmic reticulum membrane, Golgi apparatus membrane, Multi-pass membrane protein Customer validation WB(Mus musculus)
Western blot analysis of extracts of various cell lines, using ABCG1 antibody (A17907) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human ABCG1 (NP_004906.3). Isotype IgG