быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
5HT7 Receptor Rabbit mAb (A19706)
- Описание
- Характеристики
-
Overview
Product name 5HT7 Receptor Rabbit mAb Catalog No. A19706 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2238 Background
The neurotransmitter, serotonin, is thought to play a role in various cognitive and behavioral functions. The serotonin receptor encoded by this gene belongs to the superfamily of G protein-coupled receptors and the gene is a candidate locus for involvement in autistic disorder and other neuropsychiatric disorders. Three splice variants have been identified which encode proteins that differ in the length of their carboxy terminal ends.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human 5HT7 Receptor (P34969). Sequence MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTWDAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNC Gene ID Swiss Prot Synonyms 5-HT7 Calculated MW 54kDa Observed MW 54kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples C6, SH-SY5Y, U-87MG, Mouse testis, Mouse brain, Mouse spleen, Rat testis, Rat brain Cellular location dendrite, plasma membrane, synapse, Cell membrane 
Western blot analysis of extracts of various cell lines, using 5HT7 Receptor Rabbit mAb (A19706) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunofluorescence analysis of rat brain using 5HT7 Receptor Rabbit mAb (A19706) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of mouse brain using 5HT7 Receptor Rabbit mAb (A19706) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human 5HT7 Receptor (P34969). Isotype IgG