быстрая доставка ~4 недели
Размер
- 100 T
- 200 T
- 500 T
ABflo® 488 Rabbit anti-Human CD225/IFITM1 mAb (A22310)
- Описание
- Характеристики
-
Overview
Product name ABflo® 488 Rabbit anti-Human CD225/IFITM1 mAb Catalog No. A22310 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC55310-ABf488 Background
Interferon-induced transmembrane (IFITM) proteins are a family of interferon induced antiviral proteins. The family contains five members, including IFITM1, IFITM2 and IFITM3 that belong to the CD225 superfamily. The protein encoded by this gene restricts cellular entry by diverse viral pathogens, such as influenza A virus, Ebola virus and Sars-CoV-2.Immunogen information
Immunogen Recombinant fusion protein containing a sequence within amino acids 1-80 of human CD225/IFITM1 (NP_003632.4). Sequence MHKEEHEVAVLGPPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYAS Gene ID Swiss Prot Synonyms 9-27; CD225; IFI17; LEU13; DSPA2a Calculated MW 14kDa Observed MW Applications
Reactivity Human Tested applications IF/ICC FC FC(Intra) Recommended dilution - IF/ICC 1:50 - 1:200
- FC(Intra) 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Immunofluorescence Positive samples Cellular location plasma membrane 
Immunofluorescence analysis of K-562 using ABflo® 488 Rabbit anti-Human CD225/IFITM1 mAb (A22310) at dilution of 1:50 (40x lens). Blue: DAPI for nuclear staining.
Flow cytometry: 1X10^6 U-251MG cells (Low Expression, left) and K-562 cells (right) were intracellularly-stained with ABflo® 488 Rabbit anti-Human CD225/IFITM1 mAb (A22310, 2 μg/mL, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 2 μg/mL, blue line). Non-fluorescently stained cells was used as blank control (red line).
Flow cytometry: 1X10^6 K-562 cells were intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD225/IFITM1 mAb (A22310, 5 μl/Test, right).
Flow cytometry: 1X10^6 U-251MG cells (Low Expression) were intracellularly-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD225/IFITM1 mAb (A22310, 5 μl/Test, right).
-
Key applications Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence within amino acids 1-80 of human CD225/IFITM1 (NP_003632.4). Isotype IgG