![[KD Validated] Pin1 Rabbit mAb (A22470)](/upload/resize_cache/iblock/9d5/340_340_140cd750bba9870f18aada2478b24840a/ss9b40xsoaxilnybvqaagt00y51b7xc6.jpg "[KD Validated] Pin1 Rabbit mAb (A22470)")
быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
[KD Validated] Pin1 Rabbit mAb (A22470)
- Описание
- Характеристики
-
Overview
Product name [KD Validated] Pin1 Rabbit mAb Catalog No. A22470 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC57311 Background
Peptidyl-prolyl cis/trans isomerases (PPIases) catalyze the cis/trans isomerization of peptidyl-prolyl peptide bonds. This gene encodes one of the PPIases, which specifically binds to phosphorylated ser/thr-pro motifs to catalytically regulate the post-phosphorylation conformation of its substrates. The conformational regulation catalyzed by this PPIase has a profound impact on key proteins involved in the regulation of cell growth, genotoxic and other stress responses, the immune response, induction and maintenance of pluripotency, germ cell development, neuronal differentiation, and survival. This enzyme also plays a key role in the pathogenesis of Alzheimer's disease and many cancers. Multiple alternatively spliced transcript variants have been found for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-163 of human Pin1 (NP_006212.1). Sequence MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE Gene ID Swiss Prot Synonyms DOD; UBL5 Calculated MW 18kDa Observed MW Refer to figures Applications
Reactivity Human, Mouse, Rat Tested applications WB Recommended dilution - WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa, 293T, NIH/3T3, Mouse brain, PC-12, Rat brain Cellular location Cytoplasm, Nucleus, Nucleus speckle 
Western blot analysis of extracts from wild type(WT) and Pin1 knockdown (KD) 293T(KD) cells, using Pin1 antibody (A22470) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Western blot analysis of various lysates, using PIN1 antibody (A22470) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-163 of human Pin1 (NP_006212.1). Isotype IgG