быстрая доставка ~4 недели
Размер
- 100 T
- 200 T
- 500 T
ABflo® 488 Rabbit anti-Cat CD3G mAb (A22490)
- Описание
- Характеристики
-
Overview
Product name ABflo® 488 Rabbit anti-Cat CD3G mAb Catalog No. A22490 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC55138-ABf488 Background
The protein encoded by this gene is the CD3-gamma polypeptide, which together with CD3-epsilon, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. Defects in this gene are associated with T cell immunodeficiency.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 23-116 of cat CD3G (XP_003992456.3). Sequence QSKQEIPVVRVNSDREDGSVLLTCESPDKDVKWFQDGKEMTPHKKNKNIQNLGSSIKDPRGIYWCQGSKNRSRTLQVYFRMCQNCIELSRATVS Gene ID Swiss Prot Synonyms T3G; IMD17; CD3GAMMA; CD3-GAMMA Calculated MW 20kDa Observed MW Applications
Reactivity Cat Tested applications FC Recommended dilution - FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.Key application Flow Cytometry Positive samples Cellular location Plasma membrane 
Flow cytometry: 1X10^6 293F cells (negative control, left) and 293F (Transfection, right) cells were surface-stained with ABflo® 488 Rabbit anti-Cat CD3G mAb (A22490, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells was used as blank control (red line).
Flow cytometry: 1X10^6 293F (Transfection) cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Cat CD3G mAb (A22490, 5 μl/Test, right).
-
Key applications Flow Cytometry Host species Кролик Antibody type Primary Antibodies Reactivity Кошка Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 23-116 of cat CD3G (XP_003992456.3). Isotype IgG