быстрая доставка ~4 недели
Размер
- 100 T
- 200 T
- 500 T
ABflo® 488 Rabbit anti-Human CD235a/Glycophorin A mAb (A23014)
- Описание
- Характеристики
-
Overview
Product name ABflo® 488 Rabbit anti-Human CD235a/Glycophorin A mAb Catalog No. A23014 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC58031-ABf488 Background
Glycophorins A (GYPA) and B (GYPB) are major sialoglycoproteins of the human erythrocyte membrane which bear the antigenic determinants for the MN and Ss blood groups. In addition to the M or N and S or s antigens that commonly occur in all populations, about 40 related variant phenotypes have been identified. These variants include all the variants of the Miltenberger complex and several isoforms of Sta, as well as Dantu, Sat, He, Mg, and deletion variants Ena, S-s-U- and Mk. Most of the variants are the result of gene recombinations between GYPA and GYPB.Immunogen information
Immunogen Recombinant protein of human CD235a/Glycophorin A. Sequence SSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE Gene ID Swiss Prot Synonyms MN; GPA; MNS; GPSAT; PAS-2; CD235a; GPErik; HGpMiV; HGpMiXI; HGpSta(C) Calculated MW 13kDa/16kDa Observed MW Refer to figures Applications
Reactivity Human Tested applications FC Recommended dilution - FC 5 μl per 10^6 cells in 100 μl volume
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.03% proclin300, 0.2% BSA, 50% glycerol, pH7.3.Key application Flow Cytometry Positive samples Cellular location Cell membrane, Single-pass type I membrane protein 
Flow cytometry:1X10^6 THP1 cells (negative control, Left) and HEL cells (Right) were surface-stained with ABflo® 488 Rabbit anti-Human CD235a/Glycophorin A mAb(A23014, 5 μl/Test, orange line) or ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, blue line). Non-fluorescently stained cells was used as blank control (red line).
Flow cytometry:1X10^6 HEL cells were surface-stained with ABflo® 488 Rabbit IgG isotype control (A22069, 5 μl/Test, left) or ABflo® 488 Rabbit anti-Human CD235a/Glycophorin A mAb(A23014, 5 μl/Test, right).
-
Key applications Flow Cytometry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant protein of human CD235a/Glycophorin A. Isotype IgG