быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
β-Amyloid(1-42) Rabbit mAb (A24422)
- Описание
- Характеристики
-
Overview
Product name β-Amyloid(1-42) Rabbit mAb Catalog No. A24422 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC63663 Background
This gene encodes a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. In addition, two of the peptides are antimicrobial peptides, having been shown to have bacteriocidal and antifungal activities. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 691-770 of human β-Amyloid(NP_000475.1). Sequence FAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN Gene ID Swiss Prot Synonyms AAA; AD1; PN2; ABPP; APPI; CVAP; ABETA; PN-II; preA4; CTFgamma; alpha-sAPP Calculated MW 87kDa Observed MW Applications
Reactivity Mouse Tested applications IHC-P IF/ICC Recommended dilution - IHC-P 1:50 - 1:200
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.Key application Immunohistochemistry Immunofluorescence Positive samples Cellular location Membrane, Single-pass type I membrane protein, clathrin-coated pit 
Immunohistochemistry of paraffin-embedded (5XFADJ) Mouse brain using β-Amyloid(1-42) Rabbit mAb (A24422) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Perform microwave antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.Immunofluorescence analysis of 5XFADJ mouse brain and mouse brain using β-Amyloid(1-42) Rabbit mAb (A24422) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Immunohistochemistry, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 691-770 of human β-Amyloid(NP_000475.1). Isotype IgG







