быстрая доставка ~4 недели
Размер
- 100 μL
- 200 μL
- 50 μL
67kDa Laminin Receptor Rabbit mAb (A5968)
- Описание
- Характеристики
-
Overview
Product name 67kDa Laminin Receptor Rabbit mAb Catalog No. A5968 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC2109 Background
Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Many of the effects of laminin are mediated through interactions with cell surface receptors. These receptors include members of the integrin family, as well as non-integrin laminin-binding proteins. This gene encodes a high-affinity, non-integrin family, laminin receptor 1. This receptor has been variously called 67 kD laminin receptor, 37 kD laminin receptor precursor (37LRP) and p40 ribosome-associated protein. The amino acid sequence of laminin receptor 1 is highly conserved through evolution, suggesting a key biological function. It has been observed that the level of the laminin receptor transcript is higher in colon carcinoma tissue and lung cancer cell line than their normal counterparts. Also, there is a correlation between the upregulation of this polypeptide in cancer cells and their invasive and metastatic phenotype. Multiple copies of this gene exist, however, most of them are pseudogenes thought to have arisen from retropositional events. Two alternatively spliced transcript variants encoding the same protein have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 196-295 of human Laminin Receptor (P08865). Sequence EVMPDLYFYRDPEEIEKEEQAAAEKAVTKEEFQGEWTAPAPEFTATQPEVADWSEGVQVPSVPIQQFPTEDWSAQPATEDWSAAPTAQATEWVGATTDWS Gene ID Swiss Prot Synonyms SA; LBP; LRP; p40; uS2; 67LR; ICAS; lamR; 37LRP; LAMBR; LAMR1; LRP/LR; LBP/p40; NEM/1CHD4 Calculated MW 33kDa Observed MW 45kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples PC-12, A-549, BxPC-3, Raji, RAW264.7, Rat pancreas Cellular location Cytoplasm, Cytosol, Cytosolic ribosome, Extracellular exosome, Nucleoplasm, Nucleus, Plasma membrane 
Western blot analysis of extracts of various cell lines, using 67kDa Laminin Receptor Rabbit mAb (A5968) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunofluorescence analysis of NIH-3T3 cells using 67kDa Laminin Receptor Rabbit mAb (A5968) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 196-295 of human Laminin Receptor (P08865). Isotype IgG







