быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
A-RAF Rabbit mAb (A8687)
- Описание
- Характеристики
-
Overview
Product name A-RAF Rabbit mAb Catalog No. A8687 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1782 Background
Enables protein serine/threonine kinase activity. Involved in negative regulation of apoptotic process; regulation of TOR signaling; and regulation of cellular protein metabolic process. Predicted to be active in cytosol and mitochondrion. Biomarker of high grade glioma.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 166-290 of human A-RAF (P10398). Sequence RQHEAPSNRPLNELLTPQGPSPRTQHCDPEHFPFPAPANAPLQRIRSTSTPNVHMVSTTAPMDSNLIQLTGQSFSTDAAGSRGGSDGTPRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKK Gene ID Swiss Prot Synonyms PKS2; A-RAF; ARAF1; RAFA1 Calculated MW 68kDa Observed MW 68kDa Applications
Reactivity Human Tested applications WB IHC-P Recommended dilution - WB 1:500 - 1:1000
- IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunohistochemistry Positive samples HeLa, MCF7 Cellular location Cytosol, Mitochondrion Customer validation WB(Mus musculus)
Western blot analysis of extracts of various cell lines, using A-RAF antibody (A8687) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry analysis of paraffin-embedded human liver using A-RAF Rabbit mAb (A8687) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
-
Key applications Western blotting, Immunohistochemistry Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 166-290 of human A-RAF (P10398). Isotype IgG