быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ABCE1 Rabbit mAb (A9135)
- Описание
- Характеристики
-
Overview
Product name ABCE1 Rabbit mAb Catalog No. A9135 Host species Rabbit Purification method Affinity purification Isotype IgG CloneNo. ARC1445 Background
The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the OABP subfamily. Alternatively referred to as the RNase L inhibitor, this protein functions to block the activity of ribonuclease L. Activation of ribonuclease L leads to inhibition of protein synthesis in the 2-5A/RNase L system, the central pathway for viral interferon action. Two transcript variants encoding the same protein have been found for this gene.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 500-599 of human ABCE1 ( NP_002931.2). Sequence AARVVKRFILHAKKTAFVVEHDFIMATYLADRVIVFDGVPSKNTVANSPQTLLAGMNKFLSQLEITFRRDPNNYRPRINKLNSIKDVEQKKSGNYFFLDD Gene ID Swiss Prot Synonyms RLI; OABP; RLI1; ABC38; RNS4I; RNASEL1; RNASELI Calculated MW 67kDa Observed MW 67kDa Applications
Reactivity Human, Mouse Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:1000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples HeLa, HT-29, K-562, Mouse liver, Mouse spleen, Mouse pancreas Cellular location Cytoplasm, Mitochondrion 
Western blot analysis of extracts of various cell lines, using ABCE1 Rabbit mAb (A9135) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunofluorescence analysis of NIH-3T3 cells using ABCE1 Rabbit mAb (A9135) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь Immunogen A synthetic peptide corresponding to a sequence within amino acids 500-599 of human ABCE1 ( NP_002931.2). Isotype IgG