быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ZSWIM1 Rabbit pAb (A14949)
- Описание
- Характеристики
-
Overview
Product name ZSWIM1 Rabbit pAb Catalog No. A14949 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Predicted to enable zinc ion binding activity. Predicted to be located in nucleus.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 411-485 of human ZSWIM1 (NP_542170.3). Sequence DMLPAQWTAGCATSLDSILGSKWSETLDKHLAVTHLTEEVGQLLQHCTKEEFERRYSTLRELADSWIGPYEQVQL Gene ID Swiss Prot Synonyms C20orf162 Calculated MW 55kDa Observed MW 55kDa Applications
Reactivity Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse kidney Cellular location nucleus 
Western blot analysis of extracts of mouse kidney, using ZSWIM1 antibody (A14949) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 411-485 of human ZSWIM1 (NP_542170.3). Isotype IgG