быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ZNF273 Rabbit pAb (A14847)
- Описание
- Характеристики
-
Overview
Product name ZNF273 Rabbit pAb Catalog No. A14847 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene is a member of the krueppel C2H2-type zinc-finger protein family and encodes a protein with 13 C2H2-type zinc fingers and a KRAB domain. This nuclear protein is involved in transcriptional regulation. Alternative splicing results in multiple transcript variants.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 210-260 of human ZNF273 (NP_066971.2). Sequence ECGKSCCILSQLTQHKKTATRVNFYKCKTCGKAFNQFSNLTKHKIIHPEVN Gene ID Swiss Prot Synonyms HZF9 Calculated MW 65kDa Observed MW 65kDa Applications
Reactivity Human Tested applications WB Recommended dilution - WB 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples Jurkat, K-562, HAP1 Cellular location Nucleus 
Western blot analysis of various lysates, using ZNF273 antibody (A14847) at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 210-260 of human ZNF273 (NP_066971.2). Isotype IgG