быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ZNF177 Rabbit pAb (A14803)
- Описание
- Характеристики
-
Overview
Product name ZNF177 Rabbit pAb Catalog No. A14803 Host species Rabbit Purification method Affinity purification Isotype IgG Background
Enables sequence-specific double-stranded DNA binding activity. Predicted to be involved in negative regulation of transcription by RNA polymerase II. Located in blood microparticle.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 50-110 of human ZNF177 (NP_003442.2). Sequence LASVGYQLCRHSLISKVDQEQLKTDERGILQGDCADWETQLKPKDTIAMQNIPGGKTSNGI Gene ID Swiss Prot Synonyms PIGX Calculated MW 55kDa Observed MW 55kDa Applications
Reactivity Mouse Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples Mouse testis Cellular location Nucleus 
Western blot analysis of extracts of mouse testis, using ZNF177 antibody (A14803) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 2.5min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 50-110 of human ZNF177 (NP_003442.2). Isotype IgG