быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ABCA7 Rabbit pAb (A18280)
- Описание
- Характеристики
-
Overview
Product name ABCA7 Rabbit pAb Catalog No. A18280 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This full transporter has been detected predominantly in myelo-lymphatic tissues with the highest expression in peripheral leukocytes, thymus, spleen, and bone marrow. The function of this protein is not yet known; however, the expression pattern suggests a role in lipid homeostasis in cells of the immune system.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 2010-2146 of human ABCA7 (NP_061985.2). Sequence QHLKGRFAAGHTLTLRVPAARSQPAAAFVAAEFPGAELREAHGGRLRFQLPPGGRCALARVFGELAVHGAEHGVEDFSVSQTMLEEVFLYFSKDQGKDEDTEEQKEAGVGVDPAPGLQHPKRVSQFLDDPSTAETVL Gene ID Swiss Prot Synonyms AD9; ABCX; ABCA-SSN Calculated MW 234kDa Observed MW 260kDa Applications
Reactivity Human, Mouse, Rat Tested applications WB IF/ICC Recommended dilution - WB 1:500 - 1:2000
- IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Immunofluorescence Positive samples Rat brain Cellular location cell surface, endoplasmic reticulum, glial cell projection, Golgi apparatus, phagocytic cup, plasma membrane, ruffle membrane Customer validation WB(Mus musculus)
Western blot analysis of extracts of Rat brain, using ABCA7 Polyclonal Antibody (A18280) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Immunofluorescence analysis of U-251 MG cells using ABCA7 Rabbit pAb (A18280) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Western blotting, Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Мышь, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 2010-2146 of human ABCA7 (NP_061985.2). Isotype IgG