быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ABHD12 Rabbit pAb (A17678)
- Описание
- Характеристики
-
Overview
Product name ABHD12 Rabbit pAb Catalog No. A17678 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes an enzyme that catalyzes the hydrolysis of 2-arachidonoyl glycerol (2-AG), the main endocannabinoid lipid transmitter that acts on cannabinoid receptors, CB1 and CB2. The endocannabinoid system is involved in a wide range of physiological processes, including neurotransmission, mood, appetite, pain appreciation, addiction behavior, and inflammation. Mutations in this gene are associated with the neurodegenerative disease, PHARC (polyneuropathy, hearing loss, ataxia, retinitis pigmentosa, and cataract), resulting from an inborn error of endocannabinoid metabolism. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 110-250 of human ABHD12 (NP_056415.1). Sequence YFIDLKKPQDQGLNHTCNYYLQPEEDVTIGVWHTVPAVWWKNAQGKDQMWYEDALASSHPIILYLHGNAGTRGGDHRVELYKVLSSLGYHVVTFDYRGWGDSVGTPSERGMTYDALHVFDWIKARSGDNPVYIWGHSLGTG Gene ID Swiss Prot Synonyms PHARC; ABHD12A; BEM46L2; hABHD12; C20orf22; dJ965G21.2 Calculated MW 45kDa Observed MW 45kDa Applications
Reactivity Human, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples Rat brain, Rat pancreas Cellular location dendrite cytoplasm, plasma membrane 
Western blot analysis of extracts of various cell lines, using ABHD12 Rabbit pAb (A17678) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 110-250 of human ABHD12 (NP_056415.1). Isotype IgG







