быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
ABCA12 Rabbit pAb (A17680)
- Описание
- Характеристики
-
Overview
Product name ABCA12 Rabbit pAb Catalog No. A17680 Host species Rabbit Purification method Affinity purification Isotype IgG Background
The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This encoded protein is a member of the ABC1 subfamily, which is the only major ABC subfamily found exclusively in multicellular eukaryotes. Alternative splicing of this gene results in multiple transcript variants.Immunogen information
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 2456-2595 of human ABCA12 (NP_775099.2). Sequence CTRLAIMVNGKFQCIGSLQHIKSRFGRGFTVKVHLKNNKVTMETLTKFMQLHFPKTYLKDQHLSMLEYHVPVTAGGVANIFDLLETNKTALNITNFLVSQTTLEEVFINFAKDQKSYETADTSSQGSTISVDSQDDQMES Gene ID Swiss Prot Synonyms LI2; ICR2B; ARCI4A; ARCI4B Calculated MW 293kDa Observed MW Refer to figures Applications
Reactivity Mouse Tested applications IF/ICC Recommended dilution - IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Immunofluorescence Positive samples Cellular location cytoplasm, cytosol, plasma membrane 
Immunofluorescence analysis of NIH-3T3 cells using ABCA12 Polyclonal Antibody (A17680) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
-
Key applications Immunofluorescence Host species Кролик Antibody type Primary Antibodies Reactivity Мышь Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 2456-2595 of human ABCA12 (NP_775099.2). Isotype IgG