быстрая доставка ~4 недели
Размер
- 100 μL
- 20 μL
- 200 μL
- 50 μL
A2ML1 Rabbit pAb (A17831)
- Описание
- Характеристики
-
Overview
Product name A2ML1 Rabbit pAb Catalog No. A17831 Host species Rabbit Purification method Affinity purification Isotype IgG Background
This gene encodes a member of the alpha-macroglobulin superfamily. The encoded protein is thought to be an N-glycosylated monomeric protein that acts as an inhibitor of several proteases. It has been shown to form covalent interactions with proteases, and has been reported as the p170 antigen recognized by autoantibodies in the autoimmune disease paraneoplastic pemphigus (PNP; PMID:20805888). Mutations in these gene have also been associated with some cases of Noonan syndrome (NS; PMID:24939586) as well as some cases of otitis media (PMID:26121085). Alternative splicing results in multiple transcript variants encoding different isoforms.Immunogen information
Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-500 of human A2ML1 (NP_653271.3). Sequence PFTLETSGWNGTDVSLEGKFQMEDLVYNPEQVPRYYQNAYLHLRPFYSTTRSFLGIHRLNGPLKCGQPQEVLVDYYIDPADASPDQEISFSYYLIGKGSLV Gene ID Swiss Prot Synonyms OMS; p170; CPAMD9 Calculated MW 161kDa Observed MW 161kDa Applications
Reactivity Human, Rat Tested applications WB Recommended dilution - WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.Key application Western blotting Positive samples HeLa Cellular location extracellular exosome, extracellular space 
Western blot analysis of extracts of HeLa cells, using A2ML1 Rabbit pAb (A17831) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5min. -
Key applications Western blotting Host species Кролик Antibody type Primary Antibodies Reactivity Человек, Крыса Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-500 of human A2ML1 (NP_653271.3). Isotype IgG